PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr004607.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 750aa    MW: 83917.4 Da    PI: 6.7966
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr004607.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS382.74.4e-1173767471374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+a +++d++ a++lL ++++++sp gd +qRla++f+++L+arla+++s++yk l +++ts    ++ l+a++l+  +sP+ k+s+++ 
  Pbr004607.1 376 LRTLLISCAQAAAADDHRTANELLRKVRQHSSPFGDGTQRLAHCFANGLEARLAGTGSQIYKGLVSKRTS---AADFLKAYHLYLAASPFKKMSNFVS 470
                  6789************************************************************999999...9************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N +I + +e+++r+H+iDf+i +G+QWp+L+q ++ R++gpp++RiTg++ p++g   +e++eetg+rLa +Ae+++vpfe+n+ +ak++e+++leeL
  Pbr004607.1 471 NVTIRNLAEKSTRLHVIDFGILYGFQWPTLIQRISWREGGPPKVRITGIEFPQPGfrPAERVEETGRRLAAYAENFKVPFEYNA-IAKKWETITLEEL 567
                  ******************************************************9*****************************.7************ PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +++++E+l+Vnl ++ ++lldesvs++s r++vL l+++++P+++++   +  +n++ F++rf eal ++salfd+le+ +pre++er+ +E+e++gr
  Pbr004607.1 568 KIDKDEVLVVNLLYRGKNLLDESVSVDSVRNRVLALIRRINPDIFIHGIVNGAYNAPFFVTRFREALFHFSALFDMLETVVPREDQERMLIEKEIFGR 665
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  e++nv+aceg er+er et+++W+ r  +aGF+++p++ + +k a   ++  + + + ++e+s++l++gWk+r+++++SaW+
  Pbr004607.1 666 EAMNVIACEGWERVERPETYKQWQVRNLRAGFEQIPFDRELVKRAAKKVSSLYHKDFVIDENSQWLLQGWKGRTVFALSAWK 747
                  **********************************************9999999888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.291350727IPR005202Transcription factor GRAS
PfamPF035141.5E-114376747IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MDPRLRAFSD SFNGVQLGNQ PLPILSQPTV EAASRFDGKT CLDNNYRNFD YPQPGLTPNS  60
VSSYSSVSPE DDSAEDCDFS DVVLKYINQM LMEEDMEEKT CMLQESLELQ AAEKSFYEVL  120
GKKYPPSPDL YRGYAGQYGE SPGESSSGTW SNYITSSCNS GGYFGDNSSI QSPDGYSSQL  180
QGLPDYSISQ SFNGSSTRVS GLDGLVDAPS SSIYTPDLKT ESQSVWQFRK GVEEASRFLP  240
SETNLVVDLE ANGMLVHVPN VGTGAPFVKA ERKDGGEYSS GRSRGKKNLY RDDEDVEEKR  300
SSKQAAVSSE SPLRSEMFDV VLLCSTGEGR ERLGSLREAL QNGMSKSVQQ KGQSTGSNGR  360
KGRGKKLSVK REVVDLRTLL ISCAQAAAAD DHRTANELLR KVRQHSSPFG DGTQRLAHCF  420
ANGLEARLAG TGSQIYKGLV SKRTSAADFL KAYHLYLAAS PFKKMSNFVS NVTIRNLAEK  480
STRLHVIDFG ILYGFQWPTL IQRISWREGG PPKVRITGIE FPQPGFRPAE RVEETGRRLA  540
AYAENFKVPF EYNAIAKKWE TITLEELKID KDEVLVVNLL YRGKNLLDES VSVDSVRNRV  600
LALIRRINPD IFIHGIVNGA YNAPFFVTRF REALFHFSAL FDMLETVVPR EDQERMLIEK  660
EIFGREAMNV IACEGWERVE RPETYKQWQV RNLRAGFEQI PFDRELVKRA AKKVSSLYHK  720
DFVIDENSQW LLQGWKGRTV FALSAWKPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-453807478375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009349460.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM5W3W50.0M5W3W5_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s08690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein